Lineage for d5l94a_ (5l94 A:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2330957Fold a.104: Cytochrome P450 [48263] (1 superfamily)
    multihelical
  4. 2330958Superfamily a.104.1: Cytochrome P450 [48264] (2 families) (S)
  5. 2331668Family a.104.1.0: automated matches [191509] (1 protein)
    not a true family
  6. 2331669Protein automated matches [190847] (73 species)
    not a true protein
  7. 2331691Species Bacillus megaterium [TaxId:592022] [323682] (5 PDB entries)
  8. 2331696Domain d5l94a_: 5l94 A: [323704]
    automated match to d4rm4a_
    complexed with hem, tes

Details for d5l94a_

PDB Entry: 5l94 (more details), 2.25 Å

PDB Description: the 2.25 a crystal structure of cyp109e1 from bacillus megaterium in complex with testosterone
PDB Compounds: (A:) cytochrome p450

SCOPe Domain Sequences for d5l94a_:

Sequence, based on SEQRES records: (download)

>d5l94a_ a.104.1.0 (A:) automated matches {Bacillus megaterium [TaxId: 592022]}
qtkeerfnpfswyeemrntapvqwdeerqvwdvfhydgvkevleqknifssdrrppqnqr
qtalgtslinidppkhaemralvnkaftpkamkawepkiaritnellqevehledidive
hlsyplpvmviadilgvpiedqrqfkdwsdiivagpsnneretleklqqekmkandelet
yfyriieekrtrpgddiisvllqakeegkqltdeeivgfsillliagnetttnlisntiy
clmedkasferlkrekellpsgieevlryrspvqalhrivkedvtlagkklkagehvvpw
mgsahrdaeyfedpevfkidrkpnvhmafgrgihfclgaplarieakimlaelidrypqm
dwspsfelkpiestfvyglkellirknv

Sequence, based on observed residues (ATOM records): (download)

>d5l94a_ a.104.1.0 (A:) automated matches {Bacillus megaterium [TaxId: 592022]}
qtkeerfnpfswyeemrntapvqwdeerqvwdvfhydgvkevleqknifssdrrpqrqta
lgtslinidppkhaemralvnkaftpkamkawepkiaritnellqevehledidivehls
yplpvmviadilgvpiedqrqfkdwsdiivagpsnneretleklqqekmkandeletyfy
riieekrtrpgddiisvllqakeegkqltdeeivgfsillliagnetttnlisntiyclm
edkasferlkrekellpsgieevlryrspvqalhrivkedvtlagkklkagehvvpwmgs
ahrdaeyfedpevfkidrkpnvhmafgrgihfclgaplarieakimlaelidrypqmdws
psfelkpiestfvyglkellirknv

SCOPe Domain Coordinates for d5l94a_:

Click to download the PDB-style file with coordinates for d5l94a_.
(The format of our PDB-style files is described here.)

Timeline for d5l94a_: