| Class c: Alpha and beta proteins (a/b) [51349] (121 folds) |
| Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (21 families) ![]() division into families based on beta-sheet topologies |
| Family c.37.1.12: ABC transporter ATPase domain-like [52686] (14 proteins) there are two additional subdomains inserted into the central core that has a RecA-like topology |
| Protein ATP-binding subunit of the histidine permease [52687] (1 species) |
| Species Salmonella typhimurium [TaxId:90371] [52688] (1 PDB entry) |
| Domain d1b0ua_: 1b0u A: [32370] |
PDB Entry: 1b0u (more details), 1.5 Å
SCOP Domain Sequences for d1b0ua_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1b0ua_ c.37.1.12 (A:) ATP-binding subunit of the histidine permease {Salmonella typhimurium}
nklhvidlhkrygghevlkgvslqaragdvisiigssgsgkstflrcinflekpsegaii
vngqninlvrdkdgqlkvadknqlrllrtrltmvfqhfnlwshmtvlenvmeapiqvlgl
skhdareralkylakvgideraqgkypvhlsggqqqrvsiaralamepdvllfdeptsal
dpelvgevlrimqqlaeegktmvvvthemgfarhvsshviflhqgkieeegdpeqvfgnp
qsprlqqflkgslkkleh
Timeline for d1b0ua_: