SCOP 1.65: Domain d1b0ua_: 1b0u A:

Lineage for d1b0ua_ (1b0u A:)

1. Root: SCOP 1.65

2. Class c: Alpha and beta proteins (a/b) [51349] (121 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (21 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.12: ABC transporter ATPase domain-like [52686] (14 proteins)
   there are two additional subdomains inserted into the central core that has a RecA-like topology

6. Protein ATP-binding subunit of the histidine permease [52687] (1 species)

7. Species Salmonella typhimurium [TaxId:90371] [52688] (1 PDB entry)

8. Domain d1b0ua_: 1b0u A: [32370]

Details for d1b0ua_

PDB Entry: 1b0u, 1.5 Å

PDB Description: atp-binding subunit of the histidine permease from salmonella typhimurium

SCOP Domain Sequences for d1b0ua_:

Sequence; same for both SEQRES and ATOM records:

>d1b0ua_ c.37.1.12 (A:) ATP-binding subunit of the histidine permease {Salmonella typhimurium}
nklhvidlhkrygghevlkgvslqaragdvisiigssgsgkstflrcinflekpsegaii
vngqninlvrdkdgqlkvadknqlrllrtrltmvfqhfnlwshmtvlenvmeapiqvlgl
skhdareralkylakvgideraqgkypvhlsggqqqrvsiaralamepdvllfdeptsal
dpelvgevlrimqqlaeegktmvvvthemgfarhvsshviflhqgkieeegdpeqvfgnp
qsprlqqflkgslkkleh

Timeline for d1b0ua_:

• d1b0ua_ first appeared (with stable ids) in SCOP 1.55
  
• d1b0ua_ appears in SCOP 1.63
  
• d1b0ua_ appears in SCOP 1.67
  
• d1b0ua_ appears in the current release, SCOPe 2.08, called d1b0ua1