SCOPe 2.08: Domain d1b0ua1: 1b0u A:5-258

Lineage for d1b0ua1 (1b0u A:5-258)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.12: ABC transporter ATPase domain-like [52686] (25 proteins)
   there are two additional subdomains inserted into the central core that has a RecA-like topology
   missing some secondary structures that made up less than one-third of the common domain
   

6. Protein ATP-binding subunit of the histidine permease [52687] (1 species)

7. Species Salmonella typhimurium [TaxId:90371] [52688] (1 PDB entry)

8. Domain d1b0ua1: 1b0u A:5-258 [32370]
   Other proteins in same PDB: d1b0ua2
   complexed with atp, cl

Details for d1b0ua1

PDB Entry: 1b0u, 1.5 Å

PDB Description: atp-binding subunit of the histidine permease from salmonella typhimurium

PDB Compounds: (A:) histidine permease

SCOPe Domain Sequences for d1b0ua1:

Sequence; same for both SEQRES and ATOM records:

>d1b0ua1 c.37.1.12 (A:5-258) ATP-binding subunit of the histidine permease {Salmonella typhimurium [TaxId: 90371]}
nklhvidlhkrygghevlkgvslqaragdvisiigssgsgkstflrcinflekpsegaii
vngqninlvrdkdgqlkvadknqlrllrtrltmvfqhfnlwshmtvlenvmeapiqvlgl
skhdareralkylakvgideraqgkypvhlsggqqqrvsiaralamepdvllfdeptsal
dpelvgevlrimqqlaeegktmvvvthemgfarhvsshviflhqgkieeegdpeqvfgnp
qsprlqqflkgslk

Timeline for d1b0ua1:

• d1b0ua1 first appeared (with stable ids) in SCOP 1.55, called d1b0ua_
  
• d1b0ua1 appears in SCOPe 2.07