| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest |
Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families) ![]() duplication contains two domains of this fold |
| Family c.55.1.1: Actin/HSP70 [53068] (8 proteins) |
| Protein automated matches [226905] (13 species) not a true protein |
| Species Human (Homo sapiens) [TaxId:9606] [225574] (54 PDB entries) |
| Domain d5aqmc1: 5aqm C:1-188 [323699] Other proteins in same PDB: d5aqma3 automated match to d1atra1 complexed with gol, trs |
PDB Entry: 5aqm (more details), 1.63 Å
SCOPe Domain Sequences for d5aqmc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5aqmc1 c.55.1.1 (C:1-188) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mskgpavgidlgttyscvgvfqhgkveiiandqgnrttpsyvaftdterligdaaknqva
mnptntvfdakrligrrfddavvqsdmkhwpfmvvndagrpkvqveykgetksfypeevs
smvltkmkeiaeaylgktvtnavvtvpayfndsqrqatkdagtiaglnvlriineptaaa
iaygldkk
Timeline for d5aqmc1: