![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
![]() | Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) ![]() division into families based on beta-sheet topologies |
![]() | Family c.37.1.11: RecA protein-like (ATPase-domain) [52670] (22 proteins) core: mixed beta-sheet of 8 strands, order 32451678; strand 7 is antiparallel to the rest |
![]() | Protein ATP:corrinoid adenosyltransferase CobA [52684] (1 species) lacks the two last strands |
![]() | Species Salmonella typhimurium [TaxId:90371] [52685] (3 PDB entries) |
![]() | Domain d1g64b_: 1g64 B: [32369] complexed with atp, b12, mg missing some secondary structures that made up less than one-third of the common domain |
PDB Entry: 1g64 (more details), 2.1 Å
SCOPe Domain Sequences for d1g64b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1g64b_ c.37.1.11 (B:) ATP:corrinoid adenosyltransferase CobA {Salmonella typhimurium [TaxId: 90371]} qqrqqkvkdrvdarvaqaqeergiiivftgngkgkttaafgtaaravghgknvgvvqfik gtwpngernllephgvefqvmatgftwetqnreadtaacmavwqhgkrmladplldmvvl deltymvaydylpleevisalnarpghqtviitgrgchrdildladtvselrpvkhafda gvkaqmgidy
Timeline for d1g64b_: