SCOPe 2.08: Domain d5lkaa1: 5lka A:2-296

Lineage for d5lkaa1 (5lka A:2-296)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest

4. Superfamily c.69.1: alpha/beta-Hydrolases [53474] (43 families)
   many members have left-handed crossover connection between strand 8 and additional strand 9

5. Family c.69.1.8: Haloalkane dehalogenase [53513] (2 proteins)

6. Protein automated matches [190880] (5 species)
   not a true protein

7. Species Sphingobium japonicum [TaxId:332056] [323688] (1 PDB entry)

8. Domain d5lkaa1: 5lka A:2-296 [323689]
   Other proteins in same PDB: d5lkaa2
   automated match to d2qvba_
   complexed with scn; mutant

Details for d5lkaa1

PDB Entry: 5lka, 1.3 Å

PDB Description: crystal structure of haloalkane dehalogenase linb 140a+143l+177w+211l mutant (linb86) from sphingobium japonicum ut26 at 1.3 a resolution

PDB Compounds: (A:) haloalkane dehalogenase

SCOPe Domain Sequences for d5lkaa1:

Sequence; same for both SEQRES and ATOM records:

>d5lkaa1 c.69.1.8 (A:2-296) automated matches {Sphingobium japonicum [TaxId: 332056]}
slgakpfgekkfieikgrrmayidegtgdpilfqhgnptssylwrnimphcaglgrliac
dligmgdsdkldpsgperyayaehrdyldalwealdlgdrvvlvvhdwgsalgfdwarrh
rervqgiaymeaiampieaadlpeqdrdlfqafrsqageelvlqdnvfveqvlpgwilrp
lseaemaayrepflaagearrptlswprqlpiagtpadvvaiardyagwlsespipklfi
naepgalttgrmrdfcrtwpnqteitvagahfiqedspdeigaaiaafvrrlrpa

Timeline for d5lkaa1:

• d5lkaa1 first appeared in SCOPe 2.06
  
• d5lkaa1 appears in SCOPe 2.07