![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.104: Cytochrome P450 [48263] (1 superfamily) multihelical |
![]() | Superfamily a.104.1: Cytochrome P450 [48264] (2 families) ![]() |
![]() | Family a.104.1.0: automated matches [191509] (1 protein) not a true family |
![]() | Protein automated matches [190847] (99 species) not a true protein |
![]() | Species Bacillus megaterium [TaxId:592022] [323682] (5 PDB entries) |
![]() | Domain d5l91b1: 5l91 B:18-404 [323683] Other proteins in same PDB: d5l91a2, d5l91b2 automated match to d4rm4a_ complexed with c0r, hem |
PDB Entry: 5l91 (more details), 2.2 Å
SCOPe Domain Sequences for d5l91b1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5l91b1 a.104.1.0 (B:18-404) automated matches {Bacillus megaterium [TaxId: 592022]} tkeerfnpfswyeemrntapvqwdeerqvwdvfhydgvkevleqknifssdrrppqnqrq talgtslinidppkhaemralvnkaftpkamkawepkiaritnellqevehledidiveh lsyplpvmviadilgvpiedqrqfkdwsdiivagpsnneretleklqqekmkandelety fyriieekrtrpgddiisvllqakeegkqltdeeivgfsillliagnetttnlisntiyc lmedkasferlkrekellpsgieevlryrspvqalhrivkedvtlagkklkagehvvpwm gsahrdaeyfedpevfkidrkpnvhmafgrgihfclgaplarieakimlaelidrypqmd wspsfelkpiestfvyglkellirknv
Timeline for d5l91b1: