Lineage for d5kq1b2 (5kq1 B:95-240)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2971307Fold d.113: Nudix [55810] (1 superfamily)
    beta(2)-alpha-beta(3)-alpha; 3 layers: alpha/beta/alpha; mixed sheet
    contains beta-grasp motif
  4. 2971308Superfamily d.113.1: Nudix [55811] (8 families) (S)
  5. 2971774Family d.113.1.7: mRNA decapping enzyme-like [143777] (2 proteins)
    part of Pfam PF00293
  6. 2971779Protein automated matches [231207] (2 species)
    not a true protein
  7. 2971783Species Schizosaccharomyces pombe [TaxId:284812] [323649] (2 PDB entries)
  8. 2971786Domain d5kq1b2: 5kq1 B:95-240 [323680]
    Other proteins in same PDB: d5kq1b1, d5kq1b3, d5kq1e1, d5kq1e3
    automated match to d2a6ta2
    protein/RNA complex

Details for d5kq1b2

PDB Entry: 5kq1 (more details), 3 Å

PDB Description: crystal structure of s. pombe dcp1/dcp2 in complex with h. sapiens pnrc2
PDB Compounds: (B:) mRNA decapping complex subunit 2

SCOPe Domain Sequences for d5kq1b2:

Sequence, based on SEQRES records: (download)

>d5kq1b2 d.113.1.7 (B:95-240) automated matches {Schizosaccharomyces pombe [TaxId: 284812]}
ripvrgaimldmsmqqcvlvkgwkassgwgfpkgkidkdesdvdcairevyeetgfdcss
rinpnefidmtirgqnvrlyiipgisldtrfesrtrkeiskiewhnlmdlptfkknkpqt
mknkfymvipflaplkkwikkrnian

Sequence, based on observed residues (ATOM records): (download)

>d5kq1b2 d.113.1.7 (B:95-240) automated matches {Schizosaccharomyces pombe [TaxId: 284812]}
ripvrgaimldmsmqqcvlvkgwkassgwgfpkgkidkdesdvdcairevyeetgfdcss
rinpnefidmtirgqnvrlyiipgisldtrfesreiskiewhnlmdlptfkknkpmknkf
ymvipflaplkkwikkrnian

SCOPe Domain Coordinates for d5kq1b2:

Click to download the PDB-style file with coordinates for d5kq1b2.
(The format of our PDB-style files is described here.)

Timeline for d5kq1b2: