![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.242: Dcp2 domain-like [140585] (1 superfamily) 4 helices; orthogonal array of two alpha hairpins |
![]() | Superfamily a.242.1: Dcp2 domain-like [140586] (2 families) ![]() automatically mapped to Pfam PF05026 |
![]() | Family a.242.1.0: automated matches [323645] (1 protein) not a true family |
![]() | Protein automated matches [323646] (1 species) not a true protein |
![]() | Species Schizosaccharomyces pombe [TaxId:284812] [323647] (2 PDB entries) |
![]() | Domain d5kq1b1: 5kq1 B:1-94 [323679] Other proteins in same PDB: d5kq1b2, d5kq1b3, d5kq1e2, d5kq1e3 automated match to d2a6ta1 protein/RNA complex |
PDB Entry: 5kq1 (more details), 3 Å
SCOPe Domain Sequences for d5kq1b1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5kq1b1 a.242.1.0 (B:1-94) automated matches {Schizosaccharomyces pombe [TaxId: 284812]} msftnatfsqvlddlsarfilnlpaeeqssverlcfqieqahwfyedfiraqndqlpslg lrvfsaklfahcpllwkwskvheeafddflrykt
Timeline for d5kq1b1: