Lineage for d1g5ta_ (1g5t A:)

  1. Root: SCOP 1.59
  2. 115903Class c: Alpha and beta proteins (a/b) [51349] (113 folds)
  3. 121667Fold c.37: P-loop containing nucleotide triphosphate hydrolases [52539] (1 superfamily)
  4. 121668Superfamily c.37.1: P-loop containing nucleotide triphosphate hydrolases [52540] (16 families) (S)
  5. 122391Family c.37.1.11: RecA protein-like (ATPase-domain) [52670] (7 proteins)
  6. 122400Protein ATP:corrinoid adenosyltransferase CobA [52684] (1 species)
  7. 122401Species Salmonella typhimurium [TaxId:90371] [52685] (3 PDB entries)
  8. 122402Domain d1g5ta_: 1g5t A: [32366]

Details for d1g5ta_

PDB Entry: 1g5t (more details), 1.8 Å

PDB Description: the three-dimensional structure of atp:corrinoid adenosyltransferase from salmonella typhimurium. apo-atp form

SCOP Domain Sequences for d1g5ta_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1g5ta_ c.37.1.11 (A:) ATP:corrinoid adenosyltransferase CobA {Salmonella typhimurium}
ergiiivftgngkgkttaafgtaaravghgknvgvvqfikgtwpngernllephgvefqv
matgftwetqnreadtaacmavwqhgkrmladplldmvvldeltymvaydylpleevisa
lnarpghqtviitgrgchrdildladtvselrpvkha

SCOP Domain Coordinates for d1g5ta_:

Click to download the PDB-style file with coordinates for d1g5ta_.
(The format of our PDB-style files is described here.)

Timeline for d1g5ta_: