SCOPe 2.08: Domain d1g5ta_: 1g5t A:

Lineage for d1g5ta_ (1g5t A:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.11: RecA protein-like (ATPase-domain) [52670] (22 proteins)
   core: mixed beta-sheet of 8 strands, order 32451678; strand 7 is antiparallel to the rest

6. Protein ATP:corrinoid adenosyltransferase CobA [52684] (1 species)
   lacks the two last strands

7. Species Salmonella typhimurium [TaxId:90371] [52685] (3 PDB entries)

8. Domain d1g5ta_: 1g5t A: [32366]
   complexed with atp, mg
   missing some secondary structures that made up less than one-third of the common domain

Details for d1g5ta_

PDB Entry: 1g5t, 1.8 Å

PDB Description: the three-dimensional structure of atp:corrinoid adenosyltransferase from salmonella typhimurium. apo-atp form

PDB Compounds: (A:) cob(I)alamin adenosyltransferase

SCOPe Domain Sequences for d1g5ta_:

Sequence; same for both SEQRES and ATOM records:

>d1g5ta_ c.37.1.11 (A:) ATP:corrinoid adenosyltransferase CobA {Salmonella typhimurium [TaxId: 90371]}
ergiiivftgngkgkttaafgtaaravghgknvgvvqfikgtwpngernllephgvefqv
matgftwetqnreadtaacmavwqhgkrmladplldmvvldeltymvaydylpleevisa
lnarpghqtviitgrgchrdildladtvselrpvkha

Timeline for d1g5ta_:

• d1g5ta_ first appeared (with stable ids) in SCOP 1.55
  
• d1g5ta_ appears in SCOPe 2.07