Lineage for d5ceea2 (5cee A:159-389)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2426096Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2426097Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2430344Family c.2.1.0: automated matches [191313] (1 protein)
    not a true family
  6. 2430345Protein automated matches [190069] (247 species)
    not a true protein
  7. 2430454Species Aster yellows [TaxId:322098] [323657] (1 PDB entry)
  8. 2430455Domain d5ceea2: 5cee A:159-389 [323658]
    Other proteins in same PDB: d5ceea1
    automated match to d1vl6a1
    complexed with mg, nad

Details for d5ceea2

PDB Entry: 5cee (more details), 2.5 Å

PDB Description: malic enzyme from candidatus phytoplasma aywb in complex with nad and mg2+
PDB Compounds: (A:) NAD-dependent malic enzyme

SCOPe Domain Sequences for d5ceea2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5ceea2 c.2.1.0 (A:159-389) automated matches {Aster yellows [TaxId: 322098]}
dqhgtaivvaagilnalkvvkksiedvqvvingagsagmaiakmllllkvnnvvlvdktg
tlykgvanlnepqkklvevtnkyqekgtlkevlkgkdifigvsapgivtaemvatmakda
ivfalanpvpeimpdeakkggarivatgrsdfpnqvnnclafpgvfrgtldakatqitee
mkkaatyalkniikeqdlnennilptsfnkevvkqialavckvaketgvvr

SCOPe Domain Coordinates for d5ceea2:

Click to download the PDB-style file with coordinates for d5ceea2.
(The format of our PDB-style files is described here.)

Timeline for d5ceea2:

View in 3D
Domains from same chain:
(mouse over for more information)
d5ceea1