Lineage for d5ceea1 (5cee A:3-158)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2143051Fold c.58: Aminoacid dehydrogenase-like, N-terminal domain [53222] (1 superfamily)
    core: 3 layers: a/b/a; parallel beta-sheet of 4 strands; 2134
  4. 2143052Superfamily c.58.1: Aminoacid dehydrogenase-like, N-terminal domain [53223] (6 families) (S)
  5. 2143365Family c.58.1.0: automated matches [227157] (1 protein)
    not a true family
  6. 2143366Protein automated matches [226864] (29 species)
    not a true protein
  7. 2143374Species Aster yellows [TaxId:322098] [323655] (1 PDB entry)
  8. 2143375Domain d5ceea1: 5cee A:3-158 [323656]
    Other proteins in same PDB: d5ceea2
    automated match to d1vl6a2
    complexed with mg, nad

Details for d5ceea1

PDB Entry: 5cee (more details), 2.5 Å

PDB Description: malic enzyme from candidatus phytoplasma aywb in complex with nad and mg2+
PDB Compounds: (A:) NAD-dependent malic enzyme

SCOPe Domain Sequences for d5ceea1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5ceea1 c.58.1.0 (A:3-158) automated matches {Aster yellows [TaxId: 322098]}
ikekalemheknkgkvgvvskvkvqnlddlslvytpgvaepclkikenpsdvyrytmkgn
mvgvitngtavlglgnigpkaslpvmegkailfkelagidsfpicidstdsqeivnivsk
istvfgainledikspqcieiedalkakldipvfhd

SCOPe Domain Coordinates for d5ceea1:

Click to download the PDB-style file with coordinates for d5ceea1.
(The format of our PDB-style files is described here.)

Timeline for d5ceea1:

View in 3D
Domains from same chain:
(mouse over for more information)
d5ceea2