Lineage for d5kq1e1 (5kq1 E:1-94)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2020134Fold a.242: Dcp2 domain-like [140585] (1 superfamily)
    4 helices; orthogonal array of two alpha hairpins
  4. 2020135Superfamily a.242.1: Dcp2 domain-like [140586] (2 families) (S)
    automatically mapped to Pfam PF05026
  5. 2020143Family a.242.1.0: automated matches [323645] (1 protein)
    not a true family
  6. 2020144Protein automated matches [323646] (1 species)
    not a true protein
  7. 2020145Species Schizosaccharomyces pombe [TaxId:284812] [323647] (2 PDB entries)
  8. 2020149Domain d5kq1e1: 5kq1 E:1-94 [323652]
    Other proteins in same PDB: d5kq1b2, d5kq1b3, d5kq1e2, d5kq1e3
    automated match to d2a6ta1
    protein/RNA complex

Details for d5kq1e1

PDB Entry: 5kq1 (more details), 3 Å

PDB Description: crystal structure of s. pombe dcp1/dcp2 in complex with h. sapiens pnrc2
PDB Compounds: (E:) mRNA decapping complex subunit 2

SCOPe Domain Sequences for d5kq1e1:

Sequence, based on SEQRES records: (download)

>d5kq1e1 a.242.1.0 (E:1-94) automated matches {Schizosaccharomyces pombe [TaxId: 284812]}
msftnatfsqvlddlsarfilnlpaeeqssverlcfqieqahwfyedfiraqndqlpslg
lrvfsaklfahcpllwkwskvheeafddflrykt

Sequence, based on observed residues (ATOM records): (download)

>d5kq1e1 a.242.1.0 (E:1-94) automated matches {Schizosaccharomyces pombe [TaxId: 284812]}
msftnatfsqvlddlsarfilnlpaeeqssverlcfqieqahwfyedfiraqndqlpslg
lrvfsaklfahcpllwkwskvhafddflrykt

SCOPe Domain Coordinates for d5kq1e1:

Click to download the PDB-style file with coordinates for d5kq1e1.
(The format of our PDB-style files is described here.)

Timeline for d5kq1e1: