Lineage for d1c9kc_ (1c9k C:)

  1. Root: SCOP 1.59
  2. 115903Class c: Alpha and beta proteins (a/b) [51349] (113 folds)
  3. 121667Fold c.37: P-loop containing nucleotide triphosphate hydrolases [52539] (1 superfamily)
  4. 121668Superfamily c.37.1: P-loop containing nucleotide triphosphate hydrolases [52540] (16 families) (S)
  5. 122391Family c.37.1.11: RecA protein-like (ATPase-domain) [52670] (7 proteins)
  6. 122392Protein Adenosylcobinamide kinase/adenosylcobinamide phosphate guanylyltransferase CobU [52682] (1 species)
  7. 122393Species Salmonella typhimurium [TaxId:90371] [52683] (2 PDB entries)
  8. 122399Domain d1c9kc_: 1c9k C: [32365]

Details for d1c9kc_

PDB Entry: 1c9k (more details), 2.2 Å

PDB Description: the three dimensional structure of adenosylcobinamide kinase/ adenosylcobinamide phosphate gualylyltransferase (cobu) complexed with gmp: evidence for a substrate induced transferase active site

SCOP Domain Sequences for d1c9kc_:

Sequence, based on SEQRES records: (download)

>d1c9kc_ c.37.1.11 (C:) Adenosylcobinamide kinase/adenosylcobinamide phosphate guanylyltransferase CobU {Salmonella typhimurium}
milvtggarsgksrhaealigdapqvlyiatsqilddemaariqhhkdgrpahwrtaecw
rhldtlitadlapddaillecittmvtnllfalggendpeqwdyaameraiddeiqilia
acqrcpakvvlvtnevgmgivpenrlarhfrdiagrvnqrlaaaadevwlvvsgigvkik

Sequence, based on observed residues (ATOM records): (download)

>d1c9kc_ c.37.1.11 (C:) Adenosylcobinamide kinase/adenosylcobinamide phosphate guanylyltransferase CobU {Salmonella typhimurium}
milvtggarsgksrhaealigdapqvlyiatsqilhhkdgrpahwrtarhldtlitadla
pddaillecittmvtnllfalgdpeqwdyaameraiddeiqiliaacqrcpakvvlvtne
vgmgivpenrlarhfrdiagrvnqrlaaaadevwlvvsgigvkik

SCOP Domain Coordinates for d1c9kc_:

Click to download the PDB-style file with coordinates for d1c9kc_.
(The format of our PDB-style files is described here.)

Timeline for d1c9kc_: