SCOPe 2.08: Domain d5kq4b1: 5kq4 B:1-94

Lineage for d5kq4b1 (5kq4 B:1-94)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.242: Dcp2 domain-like [140585] (1 superfamily)
   4 helices; orthogonal array of two alpha hairpins

4. Superfamily a.242.1: Dcp2 domain-like [140586] (2 families)
   automatically mapped to Pfam PF05026

5. Family a.242.1.0: automated matches [323645] (1 protein)
   not a true family

6. Protein automated matches [323646] (1 species)
   not a true protein

7. Species Schizosaccharomyces pombe [TaxId:284812] [323647] (2 PDB entries)

8. Domain d5kq4b1: 5kq4 B:1-94 [323648]
   Other proteins in same PDB: d5kq4b2, d5kq4b3, d5kq4e2, d5kq4e3
   automated match to d2a6ta1
   protein/RNA complex; complexed with 6vq

Details for d5kq4b1

PDB Entry: 5kq4, 2.56 Å

PDB Description: crystal structure of s. pombe dcp1/dcp2 in complex with h. sapiens pnrc2 and synthetic cap analog

PDB Compounds: (B:) mRNA decapping complex subunit 2

SCOPe Domain Sequences for d5kq4b1:

Sequence; same for both SEQRES and ATOM records:

>d5kq4b1 a.242.1.0 (B:1-94) automated matches {Schizosaccharomyces pombe [TaxId: 284812]}
msftnatfsqvlddlsarfilnlpaeeqssverlcfqieqahwfyedfiraqndqlpslg
lrvfsaklfahcpllwkwskvheeafddflrykt

Timeline for d5kq4b1:

• d5kq4b1 first appeared in SCOPe 2.06
  
• d5kq4b1 appears in SCOPe 2.07