Lineage for d5kq4b1 (5kq4 B:1-94)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2738104Fold a.242: Dcp2 domain-like [140585] (1 superfamily)
    4 helices; orthogonal array of two alpha hairpins
  4. 2738105Superfamily a.242.1: Dcp2 domain-like [140586] (2 families) (S)
    automatically mapped to Pfam PF05026
  5. 2738113Family a.242.1.0: automated matches [323645] (1 protein)
    not a true family
  6. 2738114Protein automated matches [323646] (1 species)
    not a true protein
  7. 2738115Species Schizosaccharomyces pombe [TaxId:284812] [323647] (2 PDB entries)
  8. 2738116Domain d5kq4b1: 5kq4 B:1-94 [323648]
    Other proteins in same PDB: d5kq4b2, d5kq4b3, d5kq4e2, d5kq4e3
    automated match to d2a6ta1
    protein/RNA complex; complexed with 6vq

Details for d5kq4b1

PDB Entry: 5kq4 (more details), 2.56 Å

PDB Description: crystal structure of s. pombe dcp1/dcp2 in complex with h. sapiens pnrc2 and synthetic cap analog
PDB Compounds: (B:) mRNA decapping complex subunit 2

SCOPe Domain Sequences for d5kq4b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5kq4b1 a.242.1.0 (B:1-94) automated matches {Schizosaccharomyces pombe [TaxId: 284812]}
msftnatfsqvlddlsarfilnlpaeeqssverlcfqieqahwfyedfiraqndqlpslg
lrvfsaklfahcpllwkwskvheeafddflrykt

SCOPe Domain Coordinates for d5kq4b1:

Click to download the PDB-style file with coordinates for d5kq4b1.
(The format of our PDB-style files is described here.)

Timeline for d5kq4b1: