Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.38: Thioesterase/thiol ester dehydrase-isomerase [54636] (1 superfamily) core: beta-alpha-beta(4); 2 layers: alpha/beta |
Superfamily d.38.1: Thioesterase/thiol ester dehydrase-isomerase [54637] (10 families) |
Family d.38.1.0: automated matches [191325] (1 protein) not a true family |
Protein automated matches [190143] (42 species) not a true protein |
Species Legionella pneumophila [TaxId:446] [323639] (1 PDB entry) |
Domain d5diob_: 5dio B: [323640] automated match to d5byua_ mutant |
PDB Entry: 5dio (more details), 2.6 Å
SCOPe Domain Sequences for d5diob_:
Sequence, based on SEQRES records: (download)
>d5diob_ d.38.1.0 (B:) automated matches {Legionella pneumophila [TaxId: 446]} ihkktfdiawgdmaalghvnnaryfdyfqearidwlreldikmtgqtgpvvihvactflk pivypatvtihskvnslgnssmimdhdlyqeetlmaqgvskivwidytqnksvplpdiir nlv
>d5diob_ d.38.1.0 (B:) automated matches {Legionella pneumophila [TaxId: 446]} ihkktfdiawgdmaalghvnnaryfdyfqearidwlrelditgpvvihvactflkpivyp atvtihskvnslgnssmimdhdlyqeetlmaqgvskivwinksvplpdiirnlv
Timeline for d5diob_: