Lineage for d5diob_ (5dio B:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2943538Fold d.38: Thioesterase/thiol ester dehydrase-isomerase [54636] (1 superfamily)
    core: beta-alpha-beta(4); 2 layers: alpha/beta
  4. 2943539Superfamily d.38.1: Thioesterase/thiol ester dehydrase-isomerase [54637] (10 families) (S)
  5. 2944312Family d.38.1.0: automated matches [191325] (1 protein)
    not a true family
  6. 2944313Protein automated matches [190143] (42 species)
    not a true protein
  7. 2944441Species Legionella pneumophila [TaxId:446] [323639] (1 PDB entry)
  8. 2944442Domain d5diob_: 5dio B: [323640]
    automated match to d5byua_
    mutant

Details for d5diob_

PDB Entry: 5dio (more details), 2.6 Å

PDB Description: crystal structure of unnamed thioesterase lpg2867 from legionella pneumophila, the d21a mutant
PDB Compounds: (B:) thioesterase

SCOPe Domain Sequences for d5diob_:

Sequence, based on SEQRES records: (download)

>d5diob_ d.38.1.0 (B:) automated matches {Legionella pneumophila [TaxId: 446]}
ihkktfdiawgdmaalghvnnaryfdyfqearidwlreldikmtgqtgpvvihvactflk
pivypatvtihskvnslgnssmimdhdlyqeetlmaqgvskivwidytqnksvplpdiir
nlv

Sequence, based on observed residues (ATOM records): (download)

>d5diob_ d.38.1.0 (B:) automated matches {Legionella pneumophila [TaxId: 446]}
ihkktfdiawgdmaalghvnnaryfdyfqearidwlrelditgpvvihvactflkpivyp
atvtihskvnslgnssmimdhdlyqeetlmaqgvskivwinksvplpdiirnlv

SCOPe Domain Coordinates for d5diob_:

Click to download the PDB-style file with coordinates for d5diob_.
(The format of our PDB-style files is described here.)

Timeline for d5diob_:

View in 3D
Domains from other chains:
(mouse over for more information)
d5dioa_