Lineage for d5k2zb_ (5k2z B:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2089714Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2090271Superfamily c.1.2: Ribulose-phoshate binding barrel [51366] (7 families) (S)
  5. 2091023Family c.1.2.0: automated matches [191350] (1 protein)
    not a true family
  6. 2091024Protein automated matches [190292] (34 species)
    not a true protein
  7. 2091028Species Arabidopsis thaliana [TaxId:3702] [323630] (8 PDB entries)
  8. 2091038Domain d5k2zb_: 5k2z B: [323631]
    automated match to d3fema_
    complexed with 6r3, cl, edo, so4

Details for d5k2zb_

PDB Entry: 5k2z (more details), 1.8 Å

PDB Description: pdx1.3-adduct (arabidopsis)
PDB Compounds: (B:) Pyridoxal 5'-phosphate synthase subunit PDX1.3

SCOPe Domain Sequences for d5k2zb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5k2zb_ c.1.2.0 (B:) automated matches {Arabidopsis thaliana [TaxId: 3702]}
kspfsvkvglaqmlrggvimdvvnaeqariaeeagacavmalervpadiraqggvarmsd
pqmikeikqavtipvmakarighfveaqileaigidyidesevltladedhhinkhnfri
pfvcgcrnlgealrriregaamirtkgeagtgniieavrhvrsvngdirvlrnmdddevf
tfakklaapydlvmqtkqlgrlpvvqfaaggvatpadaalmmqlgcdgvfvgsgifksgd
parraraivqavthysdpemlvevscglgeamvginln

SCOPe Domain Coordinates for d5k2zb_:

Click to download the PDB-style file with coordinates for d5k2zb_.
(The format of our PDB-style files is described here.)

Timeline for d5k2zb_: