Lineage for d5jida_ (5jid A:)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2041484Fold b.3: Prealbumin-like [49451] (7 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands to common fold
  4. 2041793Superfamily b.3.4: Transthyretin (synonym: prealbumin) [49472] (2 families) (S)
  5. 2041794Family b.3.4.1: Transthyretin (synonym: prealbumin) [49473] (2 proteins)
    automatically mapped to Pfam PF00576
  6. 2041795Protein Transthyretin (synonym: prealbumin) [49474] (5 species)
    sandwich; 8 strands in 2 sheets
  7. 2041816Species Human (Homo sapiens) [TaxId:9606] [49475] (276 PDB entries)
    Uniprot P02766 31-143
  8. 2041889Domain d5jida_: 5jid A: [323629]
    automated match to d1f41a_
    complexed with 8pf, na

Details for d5jida_

PDB Entry: 5jid (more details), 1.2 Å

PDB Description: crystal structure of human transthyretin in complex with perfluorooctanoic acid (pfoa)
PDB Compounds: (A:) Transthyretin

SCOPe Domain Sequences for d5jida_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5jida_ b.3.4.1 (A:) Transthyretin (synonym: prealbumin) {Human (Homo sapiens) [TaxId: 9606]}
cplmvkvldavrgspainvavhvfrkaaddtwepfasgktsesgelhgltteeefvegiy
kveidtksywkalgispfhehaevvftandsgprrytiaallspysysttavvtnp

SCOPe Domain Coordinates for d5jida_:

Click to download the PDB-style file with coordinates for d5jida_.
(The format of our PDB-style files is described here.)

Timeline for d5jida_: