Lineage for d5j1da_ (5j1d A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2913607Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest
  4. 2913608Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) (S)
    Similar in architecture to the superfamily I but partly differs in topology
  5. 2915150Family c.94.1.0: automated matches [191309] (1 protein)
    not a true family
  6. 2915151Protein automated matches [190039] (161 species)
    not a true protein
  7. 2916164Species Stenotrophomonas maltophilia [TaxId:40324] [323625] (1 PDB entry)
  8. 2916165Domain d5j1da_: 5j1d A: [323626]
    automated match to d2v3qa1
    complexed with gol, po4

Details for d5j1da_

PDB Entry: 5j1d (more details), 1.9 Å

PDB Description: x-ray crystal structure of phosphate binding protein (pbp) from stenotrophomonas maltophilia
PDB Compounds: (A:) Phosphate binding protein

SCOPe Domain Sequences for d5j1da_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5j1da_ c.94.1.0 (A:) automated matches {Stenotrophomonas maltophilia [TaxId: 40324]}
atavtgggaslpadlykgsadsilpanfsyavtgsgtgkkaflennsalfsttgtvhfag
sdsvlsstelntynstynvsgdanrygalvqipsvatsvtipfnkagsavdlsvtqvcgi
fsgkitswsqlaglgrtgdiqvvyrgessgtselltrfltsacqpadvsssnlkltngvp
afsvqstfanlfttvpsnfiaapatggtalynavyaidgrvgyvgpdaipsltdatkvak
vkgfspdevsvqatletaapptgaaaenpanwvpvfgnpsagypiagytnfvfgqcykna
tvganvrgfltkhygstvvngveqgpndvairahkfipltkawrdavrarfatatnagav
nnpatcsgigrpl

SCOPe Domain Coordinates for d5j1da_:

Click to download the PDB-style file with coordinates for d5j1da_.
(The format of our PDB-style files is described here.)

Timeline for d5j1da_: