SCOPe 2.06: Domain d5jaca_: 5jac A:

Lineage for d5jaca_ (5jac A:)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.25: Ferritin-like [47239] (6 superfamilies)
   core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection

4. Superfamily a.25.1: Ferritin-like [47240] (10 families)
   contains bimetal-ion centre in the middle of the bundle

5. Family a.25.1.1: Ferritin [47241] (10 proteins)

6. Protein automated matches [190041] (27 species)
   not a true protein

7. Species Lithobates catesbeiana [TaxId:8400] [323613] (5 PDB entries)

8. Domain d5jaca_: 5jac A: [323623]
   automated match to d3shxa_
   complexed with cl, fe2, mg

Details for d5jaca_

PDB Entry: 5jac, 1.18 Å

PDB Description: sixty minutes iron loaded rana catesbeiana h' ferritin variant e57a/e136a/d140a

PDB Compounds: (A:) Ferritin, middle subunit

SCOPe Domain Sequences for d5jaca_:

Sequence; same for both SEQRES and ATOM records:

>d5jaca_ a.25.1.1 (A:) automated matches {Lithobates catesbeiana [TaxId: 8400]}
vsqvrqnyhsdceaavnrmlnlelyasytyssmyaffdrddvalhnvaeffkehshaere
haekfmkyqnkrggrvvlqdikkperdewgntleamqaalqlektvnqalldlhklatdk
vdphlcdfleseyleaqvkaikrigdfitnlkrlglpengmgeylfdkhsvke

Timeline for d5jaca_:

• d5jaca_ is new in SCOPe 2.06-stable
  
• d5jaca_ appears in SCOPe 2.07
  
• d5jaca_ appears in the current release, SCOPe 2.08