SCOPe 2.06: Domain d5iohc_: 5ioh C:

Lineage for d5iohc_ (5ioh C:)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.159: Metallo-dependent phosphatases [56299] (1 superfamily)
   4 layers: alpha/beta/beta/alpha; mixed beta sheets; contains duplication

4. Superfamily d.159.1: Metallo-dependent phosphatases [56300] (13 families)
   different families of this superfamily are groupped in a single Pfam family, Pfam PF00149

5. Family d.159.1.3: Protein serine/threonine phosphatase [56310] (6 proteins)

6. Protein Protein phosphatase-1 (PP-1) [56311] (5 species)

7. Species Human (Homo sapiens), gamma isoform [TaxId:9606] [111230] (5 PDB entries)
   Uniprot P37140 1-308

8. Domain d5iohc_: 5ioh C: [323619]
   automated match to d1s70a_

Details for d5iohc_

PDB Entry: 5ioh, 2.57 Å

PDB Description: repoman-pp1a (protein phosphatase 1, alpha isoform) holoenzyme complex

PDB Compounds: (C:) Serine/threonine-protein phosphatase PP1-alpha catalytic subunit

SCOPe Domain Sequences for d5iohc_:

Sequence; same for both SEQRES and ATOM records:

>d5iohc_ d.159.1.3 (C:) Protein phosphatase-1 (PP-1) {Human (Homo sapiens), gamma isoform [TaxId: 9606]}
lnldsiigrllevqgsrpgknvqlteneirglclksreiflsqpilleleaplkicgdih
gqyydllrlfeyggfppesnylflgdyvdrgkqsleticlllaykikypenffllrgnhe
casinriygfydeckrryniklwktftdcfnclpiaaivdekifcchgglspdlqsmeqi
rrimrptdvpdqgllcdllwsdpdkdvqgwgendrgvsftfgaevvakflhkhdldlicr
ahqvvedgyeffakrqlvtlfsapnycgefdnagammsvdetlmcsfqilkpad

Timeline for d5iohc_:

• d5iohc_ is new in SCOPe 2.06-stable
  
• d5iohc_ appears in SCOPe 2.07
  
• d5iohc_ appears in the current release, SCOPe 2.08