| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.25: Ferritin-like [47239] (6 superfamilies) core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection |
Superfamily a.25.1: Ferritin-like [47240] (10 families) ![]() contains bimetal-ion centre in the middle of the bundle |
| Family a.25.1.1: Ferritin [47241] (10 proteins) |
| Protein automated matches [190041] (34 species) not a true protein |
| Species Lithobates catesbeiana [TaxId:8400] [323613] (9 PDB entries) |
| Domain d5j93a_: 5j93 A: [323614] automated match to d3shxa_ complexed with cl, fe2, mg |
PDB Entry: 5j93 (more details), 1.1 Å
SCOPe Domain Sequences for d5j93a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5j93a_ a.25.1.1 (A:) automated matches {Lithobates catesbeiana [TaxId: 8400]}
vsqvrqnyhsdceaavnrmlnlelyasytyssmyaffdrddvalhnvaeffkehshaere
haekfmkyqnkrggrvvlqdikkperdewgntleamqaalqlektvnqalldlhklatdk
vdphlcdfleseyleaqvkaikrigdfitnlkrlglpengmgeylfdkhsv
Timeline for d5j93a_: