Lineage for d5b13f_ (5b13 F:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2685878Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 2685879Superfamily a.1.1: Globin-like [46458] (5 families) (S)
  5. 2688849Family a.1.1.3: Phycocyanin-like phycobilisome proteins [46532] (7 proteins)
    oligomers of two different types of globin-like subunits containing two extra helices at the N-terminus
    binds a bilin chromophore
    automatically mapped to Pfam PF00502
  6. 2689048Protein automated matches [190531] (23 species)
    not a true protein
  7. 2689128Species Palmaria palmata [TaxId:2822] [323523] (1 PDB entry)
  8. 2689134Domain d5b13f_: 5b13 F: [323610]
    automated match to d1eyxa_
    complexed with cyc, pub

Details for d5b13f_

PDB Entry: 5b13 (more details), 2.09 Å

PDB Description: crystal structure of phycoerythrin
PDB Compounds: (F:) Phycoerythrin alpha subunit

SCOPe Domain Sequences for d5b13f_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5b13f_ a.1.1.3 (F:) automated matches {Palmaria palmata [TaxId: 2822]}
mksvmtttisaadaagrfpsssdlesvqgniqraaarleaaeklasnheavvkeggdacf
akysylknpgeagdsqekvnkcyrdvdhymrlvnyslvvggtgpldewaiagarevyrtl
nlpsasyvaafaftrdrlcvprdmsaqaggeyvaaldyivnalt

SCOPe Domain Coordinates for d5b13f_:

Click to download the PDB-style file with coordinates for d5b13f_.
(The format of our PDB-style files is described here.)

Timeline for d5b13f_: