Lineage for d1cbub_ (1cbu B:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1845072Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 1845073Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families) (S)
    division into families based on beta-sheet topologies
  5. 1847928Family c.37.1.11: RecA protein-like (ATPase-domain) [52670] (18 proteins)
    core: mixed beta-sheet of 8 strands, order 32451678; strand 7 is antiparallel to the rest
  6. 1847929Protein Adenosylcobinamide kinase/adenosylcobinamide phosphate guanylyltransferase CobU [52682] (1 species)
    lacks the last strand 8
  7. 1847930Species Salmonella typhimurium [TaxId:90371] [52683] (2 PDB entries)
  8. 1847935Domain d1cbub_: 1cbu B: [32361]
    complexed with so4

Details for d1cbub_

PDB Entry: 1cbu (more details), 2.3 Å

PDB Description: adenosylcobinamide kinase/adenosylcobinamide phosphate guanylyltransferase (cobu) from salmonella typhimurium
PDB Compounds: (B:) adenosylcobinamide kinase/adenosylcobinamide phosphate guanylyltransferase

SCOPe Domain Sequences for d1cbub_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1cbub_ c.37.1.11 (B:) Adenosylcobinamide kinase/adenosylcobinamide phosphate guanylyltransferase CobU {Salmonella typhimurium [TaxId: 90371]}
milvtggarsgksrhaealigdapqvlyiatsqilddemaariqhhkdgrpahwrtaecw
rhldtlitadlapddaillecittmvtnllfalggendpeqwdyaameraiddeiqilia
acqrcpakvvlvtnevgmgivpenrlarhfrdiagrvnqrlaaaadevwlvvsgigvkik

SCOPe Domain Coordinates for d1cbub_:

Click to download the PDB-style file with coordinates for d1cbub_.
(The format of our PDB-style files is described here.)

Timeline for d1cbub_: