Lineage for d1cbub_ (1cbu B:)

  1. Root: SCOP 1.69
  2. 473232Class c: Alpha and beta proteins (a/b) [51349] (136 folds)
  3. 483669Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 483670Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (22 families) (S)
    division into families based on beta-sheet topologies
  5. 484903Family c.37.1.11: RecA protein-like (ATPase-domain) [52670] (14 proteins)
    core: mixed beta-sheet of 8 strands, order 32451678; strand 7 is antiparallel to the rest
  6. 484904Protein Adenosylcobinamide kinase/adenosylcobinamide phosphate guanylyltransferase CobU [52682] (1 species)
    lacks the last strand 8
  7. 484905Species Salmonella typhimurium [TaxId:90371] [52683] (2 PDB entries)
  8. 484907Domain d1cbub_: 1cbu B: [32361]

Details for d1cbub_

PDB Entry: 1cbu (more details), 2.3 Å

PDB Description: adenosylcobinamide kinase/adenosylcobinamide phosphate guanylyltransferase (cobu) from salmonella typhimurium
PDB Compounds: (B:)

SCOP Domain Sequences for d1cbub_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1cbub_ c.37.1.11 (B:) Adenosylcobinamide kinase/adenosylcobinamide phosphate guanylyltransferase CobU {Salmonella typhimurium}
milvtggarsgksrhaealigdapqvlyiatsqilddemaariqhhkdgrpahwrtaecw
rhldtlitadlapddaillecittmvtnllfalggendpeqwdyaameraiddeiqilia
acqrcpakvvlvtnevgmgivpenrlarhfrdiagrvnqrlaaaadevwlvvsgigvkik

SCOP Domain Coordinates for d1cbub_:

Click to download the PDB-style file with coordinates for d1cbub_.
(The format of our PDB-style files is described here.)

Timeline for d1cbub_: