Lineage for d1cbub_ (1cbu B:)

  1. Root: SCOP 1.55
  2. 18352Class c: Alpha and beta proteins (a/b) [51349] (97 folds)
  3. 22942Fold c.37: P-loop containing nucleotide triphosphate hydrolases [52539] (1 superfamily)
  4. 22943Superfamily c.37.1: P-loop containing nucleotide triphosphate hydrolases [52540] (14 families) (S)
  5. Family c.37.1.11: RecA protein-like (ATPase-domain) [52670] (6 proteins)
  6. 23517Protein Adenosylcobinamide kinase/adenosylcobinamide phosphate guanylyltransferase CobU [52682] (1 species)
  7. 23518Species Salmonella typhimurium [TaxId:90371] [52683] (2 PDB entries)
  8. 23520Domain d1cbub_: 1cbu B: [32361]

Details for d1cbub_

PDB Entry: 1cbu (more details), 2.3 Å

PDB Description: adenosylcobinamide kinase/adenosylcobinamide phosphate guanylyltransferase (cobu) from salmonella typhimurium

SCOP Domain Sequences for d1cbub_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1cbub_ c.37.1.11 (B:) Adenosylcobinamide kinase/adenosylcobinamide phosphate guanylyltransferase CobU {Salmonella typhimurium}
milvtggarsgksrhaealigdapqvlyiatsqilddemaariqhhkdgrpahwrtaecw
rhldtlitadlapddaillecittmvtnllfalggendpeqwdyaameraiddeiqilia
acqrcpakvvlvtnevgmgivpenrlarhfrdiagrvnqrlaaaadevwlvvsgigvkik

SCOP Domain Coordinates for d1cbub_:

Click to download the PDB-style file with coordinates for d1cbub_.
(The format of our PDB-style files is described here.)

Timeline for d1cbub_: