| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) ![]() division into families based on beta-sheet topologies |
| Family c.37.1.11: RecA protein-like (ATPase-domain) [52670] (22 proteins) core: mixed beta-sheet of 8 strands, order 32451678; strand 7 is antiparallel to the rest |
| Protein Adenosylcobinamide kinase/adenosylcobinamide phosphate guanylyltransferase CobU [52682] (1 species) lacks the last strand 8 |
| Species Salmonella typhimurium [TaxId:90371] [52683] (2 PDB entries) |
| Domain d1cbub_: 1cbu B: [32361] complexed with so4 missing some secondary structures that made up less than one-third of the common domain |
PDB Entry: 1cbu (more details), 2.3 Å
SCOPe Domain Sequences for d1cbub_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1cbub_ c.37.1.11 (B:) Adenosylcobinamide kinase/adenosylcobinamide phosphate guanylyltransferase CobU {Salmonella typhimurium [TaxId: 90371]}
milvtggarsgksrhaealigdapqvlyiatsqilddemaariqhhkdgrpahwrtaecw
rhldtlitadlapddaillecittmvtnllfalggendpeqwdyaameraiddeiqilia
acqrcpakvvlvtnevgmgivpenrlarhfrdiagrvnqrlaaaadevwlvvsgigvkik
Timeline for d1cbub_: