SCOPe 2.08: Domain d5j28a_: 5j28 A:

Lineage for d5j28a_ (5j28 A:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.159: Metallo-dependent phosphatases [56299] (1 superfamily)
   4 layers: alpha/beta/beta/alpha; mixed beta sheets; contains duplication

4. Superfamily d.159.1: Metallo-dependent phosphatases [56300] (13 families)
   different families of this superfamily are groupped in a single Pfam family, Pfam PF00149

5. Family d.159.1.3: Protein serine/threonine phosphatase [56310] (6 proteins)

6. Protein automated matches [190344] (6 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187171] (10 PDB entries)

8. Domain d5j28a_: 5j28 A: [323609]
   automated match to d3c5wc_
   complexed with mli, na

Details for d5j28a_

PDB Entry: 5j28, 2 Å

PDB Description: ki67-pp1g (protein phosphatase 1, gamma isoform) holoenzyme complex

PDB Compounds: (A:) Serine/threonine-protein phosphatase PP1-gamma catalytic subunit

SCOPe Domain Sequences for d5j28a_:

Sequence; same for both SEQRES and ATOM records:

>d5j28a_ d.159.1.3 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
lnidsiiqrllevrgskpgknvqlqeneirglclksreiflsqpilleleaplkicgdih
gqyydllrlfeyggfppesnylflgdyvdrgkqsleticlllaykikypenffllrgnhe
casinriygfydeckrryniklwktftdcfnclpiaaivdekifcchgglspdlqsmeqi
rrimrptdvpdqgllcdllwsdpdkdvlgwgendrgvsftfgaevvakflhkhdldlicr
ahqvvedgyeffakrqlvtlfsapnycgefdnagammsvdetlmcsfqilkpa

Timeline for d5j28a_:

• d5j28a_ first appeared in SCOPe 2.06
  
• d5j28a_ appears in SCOPe 2.07