SCOPe 2.08: Domain d5iytb_: 5iyt B:

Lineage for d5iytb_ (5iyt B:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
   barrel, closed; n=6, S=8; greek-key
   duplication: consists of two domains of the same fold

4. Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families)

5. Family b.47.1.4: Viral cysteine protease of trypsin fold [50603] (5 proteins)

6. Protein automated matches [190384] (21 species)
   not a true protein

7. Species Echovirus 1 (strain human/egypt/farouk/1951) [TaxId:103908] [323603] (1 PDB entry)

8. Domain d5iytb_: 5iyt B: [323604]
   automated match to d2vb0a_
   complexed with nzn

Details for d5iytb_

PDB Entry: 5iyt, 1.73 Å

PDB Description: complex structure of ev-b93 main protease 3c with n-ethyl 4-((1- cycloheptyl-1,2-dihydropyrazol-3-one-5-yl)-amino)-4-oxo-2z-butenamide

PDB Compounds: (B:) EV-B93 main protease 3C

SCOPe Domain Sequences for d5iytb_:

Sequence; same for both SEQRES and ATOM records:

>d5iytb_ b.47.1.4 (B:) automated matches {Echovirus 1 (strain human/egypt/farouk/1951) [TaxId: 103908]}
mkgpafefavammkrnastvkteygeftmlgiydrwavlprhakpgptilmndqevgvld
akelvdkdgtnleltllklnrnekfrdirgflareevevneavlaintskfpnmyipvgq
vtdygflnlggtptkrmlvynfptragqcggvlmstgkvlgihvggnghqgfsaallrhy
fn

Timeline for d5iytb_:

• d5iytb_ first appeared in SCOPe 2.06
  
• d5iytb_ appears in SCOPe 2.07