Class b: All beta proteins [48724] (180 folds) |
Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily) barrel, closed; n=6, S=8; greek-key duplication: consists of two domains of the same fold |
Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) |
Family b.47.1.4: Viral cysteine protease of trypsin fold [50603] (5 proteins) |
Protein automated matches [190384] (21 species) not a true protein |
Species Echovirus 1 (strain human/egypt/farouk/1951) [TaxId:103908] [323603] (1 PDB entry) |
Domain d5iytb_: 5iyt B: [323604] automated match to d2vb0a_ complexed with nzn |
PDB Entry: 5iyt (more details), 1.73 Å
SCOPe Domain Sequences for d5iytb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5iytb_ b.47.1.4 (B:) automated matches {Echovirus 1 (strain human/egypt/farouk/1951) [TaxId: 103908]} mkgpafefavammkrnastvkteygeftmlgiydrwavlprhakpgptilmndqevgvld akelvdkdgtnleltllklnrnekfrdirgflareevevneavlaintskfpnmyipvgq vtdygflnlggtptkrmlvynfptragqcggvlmstgkvlgihvggnghqgfsaallrhy fn
Timeline for d5iytb_: