SCOPe 2.08: Domain d5aqga1: 5aqg A:1-188

Lineage for d5aqga1 (5aqg A:1-188)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families)
   duplication contains two domains of this fold

5. Family c.55.1.1: Actin/HSP70 [53068] (8 proteins)

6. Protein automated matches [226905] (13 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [225574] (54 PDB entries)

8. Domain d5aqga1: 5aqg A:1-188 [323597]
   automated match to d1atra1
   complexed with cl, gol, trs, zjb

Details for d5aqga1

PDB Entry: 5aqg, 2.24 Å

PDB Description: fragment-based screening of hsp70 sheds light on the functional role of atp-binding site residues

PDB Compounds: (A:) Heat shock cognate 71 kDa protein

SCOPe Domain Sequences for d5aqga1:

Sequence; same for both SEQRES and ATOM records:

>d5aqga1 c.55.1.1 (A:1-188) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mskgpavgidlgttyscvgvfqhgkveiiandqgnrttpsyvaftdterligdaaknqva
mnptntvfdakrligrrfddavvqsdmkhwpfmvvndagrpkvqveykgetksfypeevs
smvltkmkeiaeaylgktvtnavvtvpayfndsqrqatkdagtiaglnvlriineptaaa
iaygldkk

Timeline for d5aqga1:

• d5aqga1 first appeared in SCOPe 2.06
  
• d5aqga1 appears in SCOPe 2.07