Lineage for d5ioha_ (5ioh A:)

  1. Root: SCOPe 2.08
  2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. Fold d.159: Metallo-dependent phosphatases [56299] (1 superfamily)
    4 layers: alpha/beta/beta/alpha; mixed beta sheets; contains duplication
  4. Superfamily d.159.1: Metallo-dependent phosphatases [56300] (13 families) (S)
    different families of this superfamily are groupped in a single Pfam family, Pfam PF00149
  5. Family d.159.1.3: Protein serine/threonine phosphatase [56310] (6 proteins)
  6. Protein Protein phosphatase-1 (PP-1) [56311] (6 species)
  7. Species Human (Homo sapiens), gamma isoform [TaxId:9606] [111230] (17 PDB entries)
    Uniprot P37140 1-308
  8. Domain d5ioha_: 5ioh A: [323594]
    automated match to d1s70a_

Details for d5ioha_

PDB Entry: 5ioh (more details), 2.57 Å

PDB Description: repoman-pp1a (protein phosphatase 1, alpha isoform) holoenzyme complex
PDB Compounds: (A:) Serine/threonine-protein phosphatase PP1-alpha catalytic subunit

SCOPe Domain Sequences for d5ioha_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5ioha_ d.159.1.3 (A:) Protein phosphatase-1 (PP-1) {Human (Homo sapiens), gamma isoform [TaxId: 9606]}
lnldsiigrllevqgsrpgknvqlteneirglclksreiflsqpilleleaplkicgdih
gqyydllrlfeyggfppesnylflgdyvdrgkqsleticlllaykikypenffllrgnhe
casinriygfydeckrryniklwktftdcfnclpiaaivdekifcchgglspdlqsmeqi
rrimrptdvpdqgllcdllwsdpdkdvqgwgendrgvsftfgaevvakflhkhdldlicr
ahqvvedgyeffakrqlvtlfsapnycgefdnagammsvdetlmcsfqilkpa

SCOPe Domain Coordinates for d5ioha_ are not available.

Timeline for d5ioha_:

Domains from other chains:
(mouse over for more information)
d5iohc_