Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families) division into families based on beta-sheet topologies |
Family c.37.1.11: RecA protein-like (ATPase-domain) [52670] (18 proteins) core: mixed beta-sheet of 8 strands, order 32451678; strand 7 is antiparallel to the rest |
Protein Central domain of beta subunit of F1 ATP synthase [88779] (4 species) |
Species Bacillus sp., strain ps3 [TaxId:1409] [88782] (1 PDB entry) |
Domain d1skye3: 1sky E:83-356 [32359] Other proteins in same PDB: d1skyb1, d1skyb2, d1skyb3, d1skye1, d1skye2 complexed with so4 |
PDB Entry: 1sky (more details), 3.2 Å
SCOPe Domain Sequences for d1skye3:
Sequence; same for both SEQRES and ATOM records: (download)
>d1skye3 c.37.1.11 (E:83-356) Central domain of beta subunit of F1 ATP synthase {Bacillus sp., strain ps3 [TaxId: 1409]} isvpvgqvtlgrvfnvlgepidlegdipadarrdpihrpapkfeelateveiletgikvv dllapyikggkiglfggagvgktvliqelihniaqehggisvfagvgertregndlyhem kdsgvisktamvfgqmneppgarmrvaltgltmaeyfrdeqgqdgllfidnifrftqags evsallgrmpsaigyqptlatemgqlqeritstakgsitsiqaiyvpaddytdpapattf shldattnlerklaemgiypavdplvstsralap
Timeline for d1skye3: