SCOPe 2.08: Domain d1skye3: 1sky E:83-356

Lineage for d1skye3 (1sky E:83-356)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.11: RecA protein-like (ATPase-domain) [52670] (22 proteins)
   core: mixed beta-sheet of 8 strands, order 32451678; strand 7 is antiparallel to the rest

6. Protein Central domain of beta subunit of F1 ATP synthase [88779] (5 species)

7. Species Bacillus sp., strain ps3 [TaxId:1409] [88782] (1 PDB entry)

8. Domain d1skye3: 1sky E:83-356 [32359]
   Other proteins in same PDB: d1skyb1, d1skyb2, d1skyb3, d1skye1, d1skye2
   complexed with so4

Details for d1skye3

PDB Entry: 1sky, 3.2 Å

PDB Description: crystal structure of the nucleotide free alpha3beta3 sub-complex of f1-atpase from the thermophilic bacillus ps3

PDB Compounds: (E:) f1-ATPase

SCOPe Domain Sequences for d1skye3:

Sequence; same for both SEQRES and ATOM records:

>d1skye3 c.37.1.11 (E:83-356) Central domain of beta subunit of F1 ATP synthase {Bacillus sp., strain ps3 [TaxId: 1409]}
isvpvgqvtlgrvfnvlgepidlegdipadarrdpihrpapkfeelateveiletgikvv
dllapyikggkiglfggagvgktvliqelihniaqehggisvfagvgertregndlyhem
kdsgvisktamvfgqmneppgarmrvaltgltmaeyfrdeqgqdgllfidnifrftqags
evsallgrmpsaigyqptlatemgqlqeritstakgsitsiqaiyvpaddytdpapattf
shldattnlerklaemgiypavdplvstsralap

Timeline for d1skye3:

• d1skye3 first appeared (with stable ids) in SCOP 1.55
  
• d1skye3 appears in SCOPe 2.07