Lineage for d5fwqa1 (5fwq A:4-208)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2820567Fold b.98: Zn aminopeptidase N-terminal domain [63736] (1 superfamily)
    duplication: two beta-sandwiches of similar topologies are fused together in a single three beta-sheet domain
  4. 2820568Superfamily b.98.1: Zn aminopeptidase N-terminal domain [63737] (2 families) (S)
  5. 2820655Family b.98.1.0: automated matches [254305] (1 protein)
    not a true family
  6. 2820656Protein automated matches [254706] (5 species)
    not a true protein
  7. 2820660Species Human (Homo sapiens) [TaxId:9606] [255964] (28 PDB entries)
  8. 2820674Domain d5fwqa1: 5fwq A:4-208 [323575]
    Other proteins in same PDB: d5fwqa2, d5fwqa3
    automated match to d3b7sa2
    complexed with act, imd, yb, zn

Details for d5fwqa1

PDB Entry: 5fwq (more details), 2.05 Å

PDB Description: apo structure of human leukotriene a4 hydrolase
PDB Compounds: (A:) human leukotriene a4 hydrolase

SCOPe Domain Sequences for d5fwqa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5fwqa1 b.98.1.0 (A:4-208) automated matches {Human (Homo sapiens) [TaxId: 9606]}
vdtcslaspasvcrtkhlhlrcsvdftrrtltgtaaltvqsqednlrslvldtkdltiek
vvingqevkyalgerqsykgspmeislpialsknqeivieisfetspkssalqwltpeqt
sgkehpylfsqcqaihcrailpcqdtpsvkltytaevsvpkelvalmsairdgetpdped
psrkiykfiqkvpipcylialvvga

SCOPe Domain Coordinates for d5fwqa1:

Click to download the PDB-style file with coordinates for d5fwqa1.
(The format of our PDB-style files is described here.)

Timeline for d5fwqa1: