Class c: Alpha and beta proteins (a/b) [51349] (130 folds) |
Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (22 families) division into families based on beta-sheet topologies |
Family c.37.1.11: RecA protein-like (ATPase-domain) [52670] (12 proteins) core: mixed beta-sheet of 8 strands, order 32451678; strand 7 is antiparallel to the rest |
Protein Central domain of beta subunit of F1 ATP synthase [88779] (4 species) |
Species Rat (Rattus norvegicus) [TaxId:10116] [88781] (1 PDB entry) |
Domain d1mabb3: 1mab B:82-357 [32357] Other proteins in same PDB: d1maba1, d1maba2, d1maba3, d1mabb1, d1mabb2, d1mabg_ complexed with adp, atp, mg, po4 |
PDB Entry: 1mab (more details), 2.8 Å
SCOP Domain Sequences for d1mabb3:
Sequence; same for both SEQRES and ATOM records: (download)
>d1mabb3 c.37.1.11 (B:82-357) Central domain of beta subunit of F1 ATP synthase {Rat (Rattus norvegicus)} ikipvgpetlgrimnvigepidergpiktkqfapihaeapefiemsveqeilvtgikvvd llapyakggkiglfggagvgktvlimelinnvakahggysvfagvgertregndlyhemi esgvinlkdatskvalvygqmneppgararvaltgltvaeyfrdqegqdvllfidnifrf tqagsevsallgripsavgyqptlatdmgtmqeritttkkgsitsvqaiyvpaddltdpa pattfahldattvlsraiaelgiypavdpldstsri
Timeline for d1mabb3:
View in 3D Domains from other chains: (mouse over for more information) d1maba1, d1maba2, d1maba3, d1mabg_ |