Lineage for d1mabb3 (1mab B:82-357)

  1. Root: SCOP 1.61
  2. 172677Class c: Alpha and beta proteins (a/b) [51349] (117 folds)
  3. 179162Fold c.37: P-loop containing nucleotide triphosphate hydrolases [52539] (1 superfamily)
  4. 179163Superfamily c.37.1: P-loop containing nucleotide triphosphate hydrolases [52540] (18 families) (S)
  5. 179955Family c.37.1.11: RecA protein-like (ATPase-domain) [52670] (7 proteins)
  6. 180008Protein Central domain of alpha and beta subunits of F1 ATP synthase [52678] (4 species)
  7. 180067Species Rat (Rattus norvegicus) [TaxId:10116] [52680] (1 PDB entry)
  8. 180069Domain d1mabb3: 1mab B:82-357 [32357]
    Other proteins in same PDB: d1maba1, d1maba2, d1mabb1, d1mabb2, d1mabg_

Details for d1mabb3

PDB Entry: 1mab (more details), 2.8 Å

PDB Description: rat liver f1-atpase

SCOP Domain Sequences for d1mabb3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mabb3 c.37.1.11 (B:82-357) Central domain of alpha and beta subunits of F1 ATP synthase {Rat (Rattus norvegicus)}
ikipvgpetlgrimnvigepidergpiktkqfapihaeapefiemsveqeilvtgikvvd
llapyakggkiglfggagvgktvlimelinnvakahggysvfagvgertregndlyhemi
esgvinlkdatskvalvygqmneppgararvaltgltvaeyfrdqegqdvllfidnifrf
tqagsevsallgripsavgyqptlatdmgtmqeritttkkgsitsvqaiyvpaddltdpa
pattfahldattvlsraiaelgiypavdpldstsri

SCOP Domain Coordinates for d1mabb3:

Click to download the PDB-style file with coordinates for d1mabb3.
(The format of our PDB-style files is described here.)

Timeline for d1mabb3: