Lineage for d5fafa1 (5faf A:151-260)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2534201Fold d.109: Gelsolin-like [55752] (3 superfamilies)
    3 layers: a/b/a; contains mixed beta-sheet
  4. 2534202Superfamily d.109.1: Actin depolymerizing proteins [55753] (3 families) (S)
  5. 2534203Family d.109.1.1: Gelsolin-like [55754] (5 proteins)
  6. 2534204Protein Gelsolin [55759] (2 species)
    consists of six similar domains
  7. 2534221Species Human (Homo sapiens) [TaxId:9606] [55761] (47 PDB entries)
    Uniprot P20065 55-179
  8. 2534222Domain d5fafa1: 5faf A:151-260 [323569]
    Other proteins in same PDB: d5fafa2
    automated match to d1kcqa_
    complexed with act, ca, cl, gol

Details for d5fafa1

PDB Entry: 5faf (more details), 1.05 Å

PDB Description: n184k pathological variant of gelsolin domain 2 (orthorhombic form)
PDB Compounds: (A:) gelsolin

SCOPe Domain Sequences for d5fafa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5fafa1 d.109.1.1 (A:151-260) Gelsolin {Human (Homo sapiens) [TaxId: 9606]}
hvvpnevvvqrlfqvkgrrvvratevpvswesfkngdcfildlgnnihqwcgsnsnryer
lkatqvskgirdnersgrarvhvseegtepeamlqvlgpkpalpagtedt

SCOPe Domain Coordinates for d5fafa1:

Click to download the PDB-style file with coordinates for d5fafa1.
(The format of our PDB-style files is described here.)

Timeline for d5fafa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d5fafa2