Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families) division into families based on beta-sheet topologies |
Family c.37.1.11: RecA protein-like (ATPase-domain) [52670] (18 proteins) core: mixed beta-sheet of 8 strands, order 32451678; strand 7 is antiparallel to the rest |
Protein Central domain of alpha subunit of F1 ATP synthase [88774] (4 species) |
Species Norway rat (Rattus norvegicus) [TaxId:10116] [88776] (2 PDB entries) |
Domain d1maba3: 1mab A:95-379 [32356] Other proteins in same PDB: d1maba1, d1maba2, d1mabb1, d1mabb2, d1mabb3, d1mabg_ complexed with adp, atp, mg, po4 |
PDB Entry: 1mab (more details), 2.8 Å
SCOPe Domain Sequences for d1maba3:
Sequence; same for both SEQRES and ATOM records: (download)
>d1maba3 c.37.1.11 (A:95-379) Central domain of alpha subunit of F1 ATP synthase {Norway rat (Rattus norvegicus) [TaxId: 10116]} vdvpvgdellgrvvdalgnaidgkgpvgskirrrvglkapgiiprisvrepmqtgikavd slvpigrgqreliigdrqtgktsiaidtiinqkrfndgtdekkklyciyvaigqkrstva qlvkrltdadamkytivvsatasdaaplqylapysgcsmgeyfrdngkhaliiyddlskq avayrqmslllrrppgreaypgdvfylhsrlleraakmndsfgggsltalpvietqagdv sayiptnvisitdgqifletelfykgirpainvglsvsrvgsaaq
Timeline for d1maba3:
View in 3D Domains from other chains: (mouse over for more information) d1mabb1, d1mabb2, d1mabb3, d1mabg_ |