Lineage for d5elwa2 (5elw A:96-207)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2930059Fold d.14: Ribosomal protein S5 domain 2-like [54210] (1 superfamily)
    core: beta(3)-alpha-beta-alpha; 2 layers: alpha/beta; left-handed crossover
  4. 2930060Superfamily d.14.1: Ribosomal protein S5 domain 2-like [54211] (13 families) (S)
  5. 2930730Family d.14.1.9: Imidazole glycerol phosphate dehydratase [102766] (2 proteins)
    duplication; there are two structural repeats of this fold
  6. 2930753Protein automated matches [254526] (2 species)
    not a true protein
  7. 2930779Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [255158] (11 PDB entries)
  8. 2930785Domain d5elwa2: 5elw A:96-207 [323558]
    Other proteins in same PDB: d5elwa1
    automated match to d4mu3a2
    complexed with 5ld, cl, edo, mn, trs

Details for d5elwa2

PDB Entry: 5elw (more details), 1.4 Å

PDB Description: a. thaliana igpd2 in complex with the triazole-phosphonate inhibitor, (r)-c348, to 1.36a resolution
PDB Compounds: (A:) Imidazoleglycerol-phosphate dehydratase 2, chloroplastic

SCOPe Domain Sequences for d5elwa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5elwa2 d.14.1.9 (A:96-207) automated matches {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
ginrfgdftapldealihvsldlsgrpylgynleiptqrvgtydtqlvehffqslvntsg
mtlhirqlagknshhiieatfkafaralrqatesdprrggtipsskgvlsrs

SCOPe Domain Coordinates for d5elwa2:

Click to download the PDB-style file with coordinates for d5elwa2.
(The format of our PDB-style files is described here.)

Timeline for d5elwa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d5elwa1