SCOPe 2.06: Domain d5elwa1: 5elw A:9-95

Lineage for d5elwa1 (5elw A:9-95)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.14: Ribosomal protein S5 domain 2-like [54210] (1 superfamily)
   core: beta(3)-alpha-beta-alpha; 2 layers: alpha/beta; left-handed crossover

4. Superfamily d.14.1: Ribosomal protein S5 domain 2-like [54211] (13 families)

5. Family d.14.1.0: automated matches [191504] (1 protein)
   not a true family

6. Protein automated matches [190826] (17 species)
   not a true protein

7. Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [259809] (9 PDB entries)

8. Domain d5elwa1: 5elw A:9-95 [323557]
   Other proteins in same PDB: d5elwa2
   automated match to d4mu3a1
   complexed with 5ld, cl, edo, mn, trs

Details for d5elwa1

PDB Entry: 5elw, 1.4 Å

PDB Description: a. thaliana igpd2 in complex with the triazole-phosphonate inhibitor, (r)-c348, to 1.36a resolution

PDB Compounds: (A:) Imidazoleglycerol-phosphate dehydratase 2, chloroplastic

SCOPe Domain Sequences for d5elwa1:

Sequence; same for both SEQRES and ATOM records:

>d5elwa1 d.14.1.0 (A:9-95) automated matches {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
sarigevkretketnvsvkinldghgvsdsstgipfldhmldqlashglfdvhvratgdt
hiddhhtnedvalaigtallkalgerk

Timeline for d5elwa1:

• d5elwa1 is new in SCOPe 2.06-stable
  
• d5elwa1 appears in SCOPe 2.07
  
• d5elwa1 appears in the current release, SCOPe 2.08