SCOPe 2.08: Domain d5e2nb_: 5e2n B:

Lineage for d5e2nb_ (5e2n B:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.74: Carbonic anhydrase [51068] (1 superfamily)
   single sheet; 10 strands

4. Superfamily b.74.1: Carbonic anhydrase [51069] (2 families)

5. Family b.74.1.1: Carbonic anhydrase [51070] (2 proteins)
   automatically mapped to Pfam PF00194

6. Protein automated matches [190681] (2 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187805] (57 PDB entries)

8. Domain d5e2nb_: 5e2n B: [323552]
   automated match to d3d0na_
   complexed with cit, edo, peg, v14, zn

Details for d5e2nb_

PDB Entry: 5e2n, 1.53 Å

PDB Description: crystal structure of human carbonic anhydrase isozyme xiii with 3- (cyclooctylamino)-2,5,6-trifluoro-4-[(2-hydroxyethyl) sulfonyl]benzenesulfonamide

PDB Compounds: (B:) Carbonic anhydrase 13

SCOPe Domain Sequences for d5e2nb_:

Sequence; same for both SEQRES and ATOM records:

>d5e2nb_ b.74.1.1 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
swgyrehngpihwkeffpiadgdqqspieiktkevkydsslrplsikydpssakiisnsg
hsfnvdfddtenksvlrggpltgsyrlrqvhlhwgsaddhgsehivdgvsyaaelhvvhw
nsdkypsfveaahepdglavlgvflqigepnsqlqkitdtldsikekgkqtrftnfdlls
llppswdywtypgsltvppllesvtwivlkqpinissqqlakfrsllctaegeaaaflvs
nhrppqplkgrkvrasfh

Timeline for d5e2nb_:

• d5e2nb_ first appeared in SCOPe 2.06
  
• d5e2nb_ appears in SCOPe 2.07