Lineage for d5dxxa_ (5dxx A:)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2413227Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2414849Superfamily c.1.4: FMN-linked oxidoreductases [51395] (2 families) (S)
  5. 2415386Family c.1.4.0: automated matches [191310] (1 protein)
    not a true family
  6. 2415387Protein automated matches [190048] (24 species)
    not a true protein
  7. 2415433Species Artemisia annua [TaxId:35608] [323541] (4 PDB entries)
  8. 2415434Domain d5dxxa_: 5dxx A: [323547]
    automated match to d2r14a_
    complexed with fmn

Details for d5dxxa_

PDB Entry: 5dxx (more details), 1.45 Å

PDB Description: crystal structure of dbr2
PDB Compounds: (A:) Artemisinic aldehyde Delta(11(13)) reductase

SCOPe Domain Sequences for d5dxxa_:

Sequence, based on SEQRES records: (download)

>d5dxxa_ c.1.4.0 (A:) automated matches {Artemisia annua [TaxId: 35608]}
kptlfsaykmgkfnlshrvvlapmtrcrainaipnealveyyrqrstaggflitegtmis
pssagfphvpgiftkeqvegwkkvvdaahkegavifcqlwhvgrashqvyqpggaapiss
tskpiskkweillpdatygtypeprplaaneilevvedyrvaainaieagfdgieihgah
gylldqfmkdgindrtdeyggslenrckfilqvvqavsaaigtdrvgirispaidhtdam
dsdprslglavierlnklqfklgsrlaylhvtqprytadghgqteagangseeevaqlmk
twrgayvgtficcggytrelglqavaqgdadlvafgryfvsnpdlvlrlklnaplnrydr
atfythdpvvgytdypsldkgsl

Sequence, based on observed residues (ATOM records): (download)

>d5dxxa_ c.1.4.0 (A:) automated matches {Artemisia annua [TaxId: 35608]}
kptlfsaykmgkfnlshrvvlapmtrcrainaipnealveyyrqrstaggflitegtmis
pssagfphvpgiftkeqvegwkkvvdaahkegavifcqlwhvgrashqvyqpggaapiss
tskpiskkweillpdatygtypeprplaaneilevvedyrvaainaieagfdgieihgah
gylldqfmkdgindrtdeyggslenrckfilqvvqavsaaigtdrvgirispaidhtdam
dsdprslglavierlnklqfklgsrlaylhvtqprytadghgqteeeevaqlmktwrgay
vgtficcggytrelglqavaqgdadlvafgryfvsnpdlvlrlklnaplnrydratfyth
dpvvgytdypsldkgsl

SCOPe Domain Coordinates for d5dxxa_:

Click to download the PDB-style file with coordinates for d5dxxa_.
(The format of our PDB-style files is described here.)

Timeline for d5dxxa_: