Lineage for d5ekwa2 (5ekw A:96-202)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2930059Fold d.14: Ribosomal protein S5 domain 2-like [54210] (1 superfamily)
    core: beta(3)-alpha-beta-alpha; 2 layers: alpha/beta; left-handed crossover
  4. 2930060Superfamily d.14.1: Ribosomal protein S5 domain 2-like [54211] (13 families) (S)
  5. 2930730Family d.14.1.9: Imidazole glycerol phosphate dehydratase [102766] (2 proteins)
    duplication; there are two structural repeats of this fold
  6. 2930753Protein automated matches [254526] (2 species)
    not a true protein
  7. 2930779Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [255158] (11 PDB entries)
  8. 2930781Domain d5ekwa2: 5ekw A:96-202 [323544]
    Other proteins in same PDB: d5ekwa1
    automated match to d4mu3a2
    complexed with 5dl, 5ld, cl, edo, mn, trs

Details for d5ekwa2

PDB Entry: 5ekw (more details), 1.1 Å

PDB Description: a. thaliana igpd2 in complex with the racemate of the triazole- phosphonate inhibitor, c348
PDB Compounds: (A:) Imidazoleglycerol-phosphate dehydratase 2, chloroplastic

SCOPe Domain Sequences for d5ekwa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5ekwa2 d.14.1.9 (A:96-202) automated matches {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
ginrfgdftapldealihvsldlsgrpylgynleiptqrvgtydtqlvehffqslvntsg
mtlhirqlagknshhiieatfkafaralrqatesdprrggtipsskg

SCOPe Domain Coordinates for d5ekwa2:

Click to download the PDB-style file with coordinates for d5ekwa2.
(The format of our PDB-style files is described here.)

Timeline for d5ekwa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d5ekwa1