![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.14: Ribosomal protein S5 domain 2-like [54210] (1 superfamily) core: beta(3)-alpha-beta-alpha; 2 layers: alpha/beta; left-handed crossover |
![]() | Superfamily d.14.1: Ribosomal protein S5 domain 2-like [54211] (13 families) ![]() |
![]() | Family d.14.1.9: Imidazole glycerol phosphate dehydratase [102766] (2 proteins) duplication; there are two structural repeats of this fold |
![]() | Protein automated matches [254526] (2 species) not a true protein |
![]() | Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [255158] (11 PDB entries) |
![]() | Domain d5ekwa2: 5ekw A:96-202 [323544] Other proteins in same PDB: d5ekwa1 automated match to d4mu3a2 complexed with 5dl, 5ld, cl, edo, mn, trs |
PDB Entry: 5ekw (more details), 1.1 Å
SCOPe Domain Sequences for d5ekwa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d5ekwa2 d.14.1.9 (A:96-202) automated matches {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} ginrfgdftapldealihvsldlsgrpylgynleiptqrvgtydtqlvehffqslvntsg mtlhirqlagknshhiieatfkafaralrqatesdprrggtipsskg
Timeline for d5ekwa2: