SCOPe 2.06: Domain d5dyma_: 5dym A:

Lineage for d5dyma_ (5dym A:)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (85 families)
   contains a small beta-sheet (wing)

5. Family a.4.5.0: automated matches [191329] (1 protein)
   not a true family

6. Protein automated matches [190154] (68 species)
   not a true protein

7. Species Peptoclostridium difficile [TaxId:645463] [323539] (1 PDB entry)

8. Domain d5dyma_: 5dym A: [323540]
   automated match to d1xmaa_

Details for d5dyma_

PDB Entry: 5dym, 1.89 Å

PDB Description: crystal structure of a padr family transcription regulator from hypervirulent clostridium difficile r20291 - cdpadr_0991 to 1.89 angstrom resolution

PDB Compounds: (A:) PadR-family transcriptional regulator

SCOPe Domain Sequences for d5dyma_:

Sequence, based on SEQRES records:

>d5dyma_ a.4.5.0 (A:) automated matches {Peptoclostridium difficile [TaxId: 645463]}
gyidilivsilekkdcygyeiakqvrersefelkegtmylalkrmesknliksyysneqs
sggrrkyynltnegkdfleikkqewrfikkvmnqflg

Sequence, based on observed residues (ATOM records):

>d5dyma_ a.4.5.0 (A:) automated matches {Peptoclostridium difficile [TaxId: 645463]}
gyidilivsilekkdcygyeiakqvrerseflkegtmylalkrmesknliksyysneqss
ggrrkyynltnegkdfleikkqewrfikkvmnqflg

Timeline for d5dyma_:

• d5dyma_ is new in SCOPe 2.06-stable
  
• d5dyma_ appears in SCOPe 2.07
  
• d5dyma_ appears in the current release, SCOPe 2.08