Lineage for d5aqqc2 (5aqq C:189-381)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2460924Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 2460925Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families) (S)
    duplication contains two domains of this fold
  5. 2460926Family c.55.1.1: Actin/HSP70 [53068] (8 proteins)
  6. 2461320Protein automated matches [226905] (13 species)
    not a true protein
  7. 2461376Species Human (Homo sapiens) [TaxId:9606] [225574] (49 PDB entries)
  8. 2461515Domain d5aqqc2: 5aqq C:189-381 [323533]
    Other proteins in same PDB: d5aqqc3
    automated match to d1atra2
    complexed with bbw, dms, gol, trs

Details for d5aqqc2

PDB Entry: 5aqq (more details), 2.72 Å

PDB Description: fragment-based screening of hsp70 sheds light on the functional role of atp-binding site residues
PDB Compounds: (C:) Heat shock cognate 71 kDa protein

SCOPe Domain Sequences for d5aqqc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5aqqc2 c.55.1.1 (C:189-381) automated matches {Human (Homo sapiens) [TaxId: 9606]}
vgaernvlifdlgggtfdvsiltiedgifevkstagdthlggedfdnrmvnhfiaefkrk
hkkdisenkravrrlrtacerakrtlssstqasieidslyegidfytsitrarfeelnad
lfrgtldpvekalrdakldksqihdivlvggstripkiqkllqdffngkelnksinpdea
vaygaavqaails

SCOPe Domain Coordinates for d5aqqc2:

Click to download the PDB-style file with coordinates for d5aqqc2.
(The format of our PDB-style files is described here.)

Timeline for d5aqqc2: