Lineage for d5dj9a_ (5dj9 A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2895166Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies)
    main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest
  4. 2895167Superfamily c.67.1: PLP-dependent transferases [53383] (10 families) (S)
  5. 2896671Family c.67.1.0: automated matches [191328] (1 protein)
    not a true family
  6. 2896672Protein automated matches [190151] (166 species)
    not a true protein
  7. 2898142Species Toxoplasma gondii [TaxId:508771] [256372] (8 PDB entries)
  8. 2898145Domain d5dj9a_: 5dj9 A: [323531]
    automated match to d5eqcb_
    complexed with btb, pxg, so4, trs

Details for d5dj9a_

PDB Entry: 5dj9 (more details), 1.55 Å

PDB Description: crystal structure of the ornithine aminotransferase from toxoplasma gondii me49 in a complex with gabaculine
PDB Compounds: (A:) Ornithine aminotransferase, mitochondrial

SCOPe Domain Sequences for d5dj9a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5dj9a_ c.67.1.0 (A:) automated matches {Toxoplasma gondii [TaxId: 508771]}
ktnieayrdglklkteedffacdrqyvcqnyapvpvviskgkgarvwdingneyydflag
vsslsqghchprviaalcrqaerltltlrafgndvtgpacrfmaemfgydrvllmntgae
agesalkiarkwayevkeippdsakvilcnnnywgrtitacsssttfdcynnfgpftpgf
elidyddvgaleealkdpnvaaffvepiqgeggvnvpkpgylkrahelcrsknvllivde
iqtglcrtgrllaadhdevhpdilllgkslsagvvpisavmgradvmdvlkpgthgstfg
gnplacavavealtvlkdekladraerlgaqfrdclrrelygkvpwikeirgrgllnave
vdsdaidpndvvmklkengilskptrgrvmrfipplvitdeehrdattriiksflaveee
r

SCOPe Domain Coordinates for d5dj9a_:

Click to download the PDB-style file with coordinates for d5dj9a_.
(The format of our PDB-style files is described here.)

Timeline for d5dj9a_: