SCOPe 2.08: Domain d5aqpc2: 5aqp C:189-381

Lineage for d5aqpc2 (5aqp C:189-381)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families)
   duplication contains two domains of this fold

5. Family c.55.1.1: Actin/HSP70 [53068] (8 proteins)

6. Protein automated matches [226905] (13 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [225574] (54 PDB entries)

8. Domain d5aqpc2: 5aqp C:189-381 [323515]
   Other proteins in same PDB: d5aqpa3
   automated match to d1atra2
   complexed with 1lq, dms, gol, trs

Details for d5aqpc2

PDB Entry: 5aqp, 2.08 Å

PDB Description: fragment-based screening of hsp70 sheds light on the functional role of atp-binding site residues

PDB Compounds: (C:) Heat shock cognate 71 kDa protein

SCOPe Domain Sequences for d5aqpc2:

Sequence; same for both SEQRES and ATOM records:

>d5aqpc2 c.55.1.1 (C:189-381) automated matches {Human (Homo sapiens) [TaxId: 9606]}
vgaernvlifdlgggtfdvsiltiedgifevkstagdthlggedfdnrmvnhfiaefkrk
hkkdisenkravrrlrtacerakrtlssstqasieidslyegidfytsitrarfeelnad
lfrgtldpvekalrdakldksqihdivlvggstripkiqkllqdffngkelnksinpdea
vaygaavqaails

Timeline for d5aqpc2:

• d5aqpc2 first appeared in SCOPe 2.06
  
• d5aqpc2 appears in SCOPe 2.07