Lineage for d1cowb3 (1cow B:95-379)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2473887Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2473888Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) (S)
    division into families based on beta-sheet topologies
  5. 2477556Family c.37.1.11: RecA protein-like (ATPase-domain) [52670] (21 proteins)
    core: mixed beta-sheet of 8 strands, order 32451678; strand 7 is antiparallel to the rest
  6. 2477617Protein Central domain of alpha subunit of F1 ATP synthase [88774] (5 species)
  7. 2477636Species Cow (Bos taurus) [TaxId:9913] [88775] (15 PDB entries)
    Uniprot P19483
  8. 2477680Domain d1cowb3: 1cow B:95-379 [32351]
    Other proteins in same PDB: d1cowa1, d1cowa2, d1cowb1, d1cowb2, d1cowc1, d1cowc2, d1cowd1, d1cowd2, d1cowd3, d1cowe1, d1cowe2, d1cowe3, d1cowf1, d1cowf2, d1cowf3, d1cowg_
    complexed with adp, anp, aur, mg

Details for d1cowb3

PDB Entry: 1cow (more details), 3.1 Å

PDB Description: bovine mitochondrial f1-atpase complexed with aurovertin b
PDB Compounds: (B:) bovine mitochondrial f1-ATPase

SCOPe Domain Sequences for d1cowb3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1cowb3 c.37.1.11 (B:95-379) Central domain of alpha subunit of F1 ATP synthase {Cow (Bos taurus) [TaxId: 9913]}
vdvpvgeellgrvvdalgnaidgkgpigskarrrvglkapgiiprisvrepmqtgikavd
slvpigrgqreliigdrqtgktsiaidtiinqkrfndgtdekkklyciyvaigqkrstva
qlvkrltdadamkytivvsatasdaaplqylapysgcsmgeyfrdngkhaliiyddlskq
avayrqmslllrrppgreaypgdvfylhsrlleraakmndafgggsltalpvietqagdv
sayiptnvisitdgqifletelfykgirpainvglsvsrvgsaaq

SCOPe Domain Coordinates for d1cowb3:

Click to download the PDB-style file with coordinates for d1cowb3.
(The format of our PDB-style files is described here.)

Timeline for d1cowb3: