Lineage for d5aqpc1 (5aqp C:1-188)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2460924Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 2460925Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families) (S)
    duplication contains two domains of this fold
  5. 2460926Family c.55.1.1: Actin/HSP70 [53068] (8 proteins)
  6. 2461320Protein automated matches [226905] (13 species)
    not a true protein
  7. 2461376Species Human (Homo sapiens) [TaxId:9606] [225574] (49 PDB entries)
  8. 2461481Domain d5aqpc1: 5aqp C:1-188 [323504]
    Other proteins in same PDB: d5aqpa3
    automated match to d1atra1
    complexed with 1lq, dms, gol, trs

Details for d5aqpc1

PDB Entry: 5aqp (more details), 2.08 Å

PDB Description: fragment-based screening of hsp70 sheds light on the functional role of atp-binding site residues
PDB Compounds: (C:) Heat shock cognate 71 kDa protein

SCOPe Domain Sequences for d5aqpc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5aqpc1 c.55.1.1 (C:1-188) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mskgpavgidlgttyscvgvfqhgkveiiandqgnrttpsyvaftdterligdaaknqva
mnptntvfdakrligrrfddavvqsdmkhwpfmvvndagrpkvqveykgetksfypeevs
smvltkmkeiaeaylgktvtnavvtvpayfndsqrqatkdagtiaglnvlriineptaaa
iaygldkk

SCOPe Domain Coordinates for d5aqpc1:

Click to download the PDB-style file with coordinates for d5aqpc1.
(The format of our PDB-style files is described here.)

Timeline for d5aqpc1: